Dystrobrevin beta Antibody
| Name | Dystrobrevin beta Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56492 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DTNB(dystrobrevin, beta) The peptide sequence was selected from the C terminal of DTNB. Peptide sequence ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DTNB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dystrobrevin beta Antibody [NBP1-56492] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16451_Dystrobrevin-beta-Antibody-Western-Blot-NBP1-56492-img0003.jpg)
Western Blot: Dystrobrevin beta Antibody [NBP1-56492] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.