Name | PSF1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56488 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to GINS1(GINS complex subunit 1 (Psf1 homolog)) The peptide sequence was selected from the N terminal of GINS1. Peptide sequence MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | GINS1 |
Conjugate | Unconjugated |
Supplier Page | Shop |