PSF1 Antibody

Name PSF1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56488
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GINS1(GINS complex subunit 1 (Psf1 homolog)) The peptide sequence was selected from the N terminal of GINS1. Peptide sequence MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene GINS1
Conjugate Unconjugated
Supplier Page Shop

Product images