ANKRD5 Antibody

Name ANKRD5 Antibody
Supplier Novus Biologicals
Catalog NBP1-56444
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANKRD5 (ankyrin repeat domain 5) The peptide sequence was selected from the N terminal of ANKRD5. Peptide sequence MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKEF1
Conjugate Unconjugated
Supplier Page Shop

Product images