GPR87 Antibody

Name GPR87 Antibody
Supplier Novus Biologicals
Catalog NBP1-56442
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GPR87 (G protein-coupled receptor 87) The peptide sequence was selected from the middle region of GPR87)(50ug). Peptide sequence NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GPR87
Conjugate Unconjugated
Supplier Page Shop

Product images