PARP12 Antibody
| Name | PARP12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56436 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PARP12(poly (ADP-ribose) polymerase family, member 12) The peptide sequence was selected from the middle region of PARP12. Peptide sequence FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PARP12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PARP12 Antibody [NBP1-56436] - ACHN cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22673_PARP12-Antibody-Western-Blot-NBP1-56436-img0002.jpg)
![Immunohistochemistry: PARP12 Antibody [NBP1-56436] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22674_PARP12-Antibody-Immunohistochemistry-NBP1-56436-img0003.jpg)