TTC12 Antibody

Name TTC12 Antibody
Supplier Novus Biologicals
Catalog NBP1-56424
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TTC12(tetratricopeptide repeat domain 12) The peptide sequence was selected from the C terminal of TTC12. Peptide sequence MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TTC12
Conjugate Unconjugated
Supplier Page Shop

Product images