NRARP Antibody

Name NRARP Antibody
Supplier Novus Biologicals
Catalog NBP1-56421
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NRARP(Notch-regulated ankyrin repeat protein) The peptide sequence was selected from the middle region of NRARP (NP_001004354). Peptide sequence QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NRARP
Conjugate Unconjugated
Supplier Page Shop

Product images