Methyltransferase like 5 Antibody
| Name | Methyltransferase like 5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56640 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to METTL5(methyltransferase like 5) The peptide sequence was selected from the N terminal of METTL5. Peptide sequence IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | METTL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Methyltransferase like 5 Antibody [NBP1-56640] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HT1080 cell lysate METTL5 is supported by BioGPS gene expression data to be expressed in HT1080](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14476_Methyltransferase%2520like%25205%2520Antibody-Western%2520Blot-NBP1-56640-img0004.jpg)
Western Blot: Methyltransferase like 5 Antibody [NBP1-56640] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HT1080 cell lysate METTL5 is supported by BioGPS gene expression data to be expressed in HT1080
![Immunohistochemistry: Methyltransferase like 5 Antibody [NBP1-56640] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14477_Methyltransferase-like-5-Antibody-Immunohistochemistry-NBP1-56640-img0003.jpg)
Immunohistochemistry: Methyltransferase like 5 Antibody [NBP1-56640] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec