LIX1 Antibody

Name LIX1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56637
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LIX1(Lix1 homolog (chicken)) The peptide sequence was selected from the N terminal of LIX1. Peptide sequence TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LIX1
Conjugate Unconjugated
Supplier Page Shop

Product images