PPM1M Antibody

Name PPM1M Antibody
Supplier Novus Biologicals
Catalog NBP1-56630
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPM1M (protein phosphatase, Mg2+/Mn2+ dependent, 1M) The peptide sequence was selected from the middle region of PPM1M. Peptide sequence VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPM1M
Conjugate Unconjugated
Supplier Page Shop

Product images