TADA1L Antibody

Name TADA1L Antibody
Supplier Novus Biologicals
Catalog NBP1-56629
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TADA1L(transcriptional adaptor 1 (HFI1 homolog, yeast)-like) The peptide sequence was selected from the C terminal of TADA1L (NP_444281). Peptide sequence REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TADA1
Conjugate Unconjugated
Supplier Page Shop

Product images