ANKMY2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56599
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2. Peptide sequence DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ANKMY2
• Conjugate: Unconjugated