LDHD Antibody

Name LDHD Antibody
Supplier Novus Biologicals
Catalog NBP1-56558
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LDHD(lactate dehydrogenase D) The peptide sequence was selected from the middle region of LDHD. Peptide sequence LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LDHD
Conjugate Unconjugated
Supplier Page Shop

Product images