PLS1 Antibody

Name PLS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56555
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to PLS1(plastin 1 (I isoform)) The peptide sequence was selected from the N terminal of PLS1. Peptide sequence ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PLS1
Supplier Page Shop

Product images