ARL8B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56544
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ARL8B(ADP-ribosylation factor-like 8B) The peptide sequence was selected from the middle region of ARL8B (NP_060654). Peptide sequence DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ARL8B
• Conjugate: Unconjugated