UEVLD Antibody

Name UEVLD Antibody
Supplier Novus Biologicals
Catalog NBP1-56538
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UEVLD(UEV and lactate/malate dehyrogenase domains) The peptide sequence was selected from the N terminal of UEVLD. Peptide sequence FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UEVLD
Conjugate Unconjugated
Supplier Page Shop

Product images