LYPLA2 Antibody
| Name | LYPLA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56653 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LYPLA2(lysophospholipase II) The peptide sequence was selected from the N terminal of LYPLA2. Peptide sequence MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LYPLA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LYPLA2 Antibody [NBP1-56653] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24103_LYPLA2-Antibody-Western-Blot-NBP1-56653-img0003.jpg)
Western Blot: LYPLA2 Antibody [NBP1-56653] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
![Immunocytochemistry/Immunofluorescence: LYPLA2 Antibody [NBP1-56653] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24104_LYPLA2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-56653-img0004.jpg)
Immunocytochemistry/Immunofluorescence: LYPLA2 Antibody [NBP1-56653] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100