LYPLA2 Antibody

Name LYPLA2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56653
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptides corresponding to LYPLA2(lysophospholipase II) The peptide sequence was selected from the N terminal of LYPLA2. Peptide sequence MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LYPLA2
Conjugate Unconjugated
Supplier Page Shop

Product images