Tropomodulin 3 Antibody
| Name | Tropomodulin 3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56652 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMOD3(tropomodulin 3 (ubiquitous)) The peptide sequence was selected from the middle region of TMOD3. Peptide sequence ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMOD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Tropomodulin 3 Antibody [NBP1-56652] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14795_Tropomodulin%25203%2520Antibody-Western%2520Blot-NBP1-56652-img0002.jpg)
Western Blot: Tropomodulin 3 Antibody [NBP1-56652] - HepG2 cell lysate, concentration 0.2-1 ug/ml.