ERP44 Antibody

Name ERP44 Antibody
Supplier Novus Biologicals
Catalog NBP1-56623
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ERP44 The peptide sequence was selected from the middle region of TXNDC4. Peptide sequence LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ERP44
Conjugate Unconjugated
Supplier Page Shop

Product images