PGM2L1 Antibody

Name PGM2L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56592
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PGM2L1(phosphoglucomutase 2-like 1) The peptide sequence was selected from the N terminal of PGM2L1. Peptide sequence KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PGM2L1
Conjugate Unconjugated
Supplier Page Shop

Product images