SSBP3 Antibody

Name SSBP3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56591
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SSBP3(single stranded DNA binding protein 3) The peptide sequence was selected from the middle region of SSBP3. Peptide sequence DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SSBP3
Conjugate Unconjugated
Supplier Page Shop

Product images