LSM14A Antibody
| Name | LSM14A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56588 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LSM14A(LSM14A, SCD6 homolog A (S. cerevisiae)) The peptide sequence was selected from the middle region of LSM14A. Peptide sequence TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LSM14A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LSM14A Antibody [NBP1-56588] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24731_LSM14A-Antibody-Western-Blot-NBP1-56588-img0003.jpg)
![Western Blot: LSM14A Antibody [NBP1-56588] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24732_LSM14A-Antibody-Western-Blot-NBP1-56588-img0002.jpg)
![Western Blot: LSM14A Antibody [NBP1-56588] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24733_LSM14A%2520Antibody-Western%2520Blot-NBP1-56588-img0004.jpg)