ARL8B Antibody

Name ARL8B Antibody
Supplier Novus Biologicals
Catalog NBP1-56577
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARL8B(ADP-ribosylation factor-like 8B) The peptide sequence was selected from the middle region of ARL8B. Peptide sequence SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARL8B
Conjugate Unconjugated
Supplier Page Shop

Product images