Proteasome 20S beta 6 Antibody
| Name | Proteasome 20S beta 6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56575 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Pig, Dog, Zebrafish |
| Antigen | Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PSMB6 |
| Supplier Page | Shop |
![Western Blot: Proteasome 20S beta 6 Antibody [NBP1-56575] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9406_Proteasome%252020S%2520beta%25206%2520Antibody-Western%2520Blot-NBP1-56575-img0003.jpg)
![Western Blot: Proteasome 20S beta 6 Antibody [NBP1-56575] - Human NT-2 cells and Mouse WT brain, concentration 2ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9407_Proteasome%252020S%2520beta%25206%2520Antibody-Western%2520Blot-NBP1-56575-img0002.jpg)