PPM1J Antibody

Name PPM1J Antibody
Supplier Novus Biologicals
Catalog NBP1-56574
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPM1J(protein phosphatase 1J (PP2C domain containing)) The peptide sequence was selected from the N terminal of PPM1J. Peptide sequence TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPM1J
Conjugate Unconjugated
Supplier Page Shop

Product images