ACTR3B Antibody

Name ACTR3B Antibody
Supplier Novus Biologicals
Catalog NBP1-56569
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B (NP_065178). Peptide sequence DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACTR3B
Conjugate Unconjugated
Supplier Page Shop

Product images