Name | ACTR3B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56569 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B (NP_065178). Peptide sequence DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ACTR3B |
Conjugate | Unconjugated |
Supplier Page | Shop |