Name | CaMKV Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56677 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse |
Antigen | Synthetic peptides corresponding to CAMKV(CaM kinase-like vesicle-associated) The peptide sequence was selected from the N terminal of CAMKV. Peptide sequence NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CAMKV |
Supplier Page | Shop |