CaMKV Antibody

Name CaMKV Antibody
Supplier Novus Biologicals
Catalog NBP1-56677
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse
Antigen Synthetic peptides corresponding to CAMKV(CaM kinase-like vesicle-associated) The peptide sequence was selected from the N terminal of CAMKV. Peptide sequence NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CAMKV
Supplier Page Shop

Product images