EHD4 Antibody

Name EHD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-54872
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EHD4(EH-domain containing 4) The peptide sequence was selected from the middle region of EHD4. Peptide sequence KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EHD4
Conjugate Unconjugated
Supplier Page Shop

Product images