HMGCS2 Antibody
| Name | HMGCS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54869 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HMGCS2(3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)) The peptide sequence was selected from the N terminal of HMGCS2. Peptide sequence PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSV |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | HMGCS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HMGCS2 Antibody [NBP1-54869] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14357_HMGCS2-Antibody-Western-Blot-NBP1-54869-img0003.jpg)
Western Blot: HMGCS2 Antibody [NBP1-54869] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
![Western Blot: HMGCS2 Antibody [NBP1-54869] - Jurkat cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14358_HMGCS2-Antibody-Western-Blot-NBP1-54869-img0002.jpg)
Western Blot: HMGCS2 Antibody [NBP1-54869] - Jurkat cell lysate, concentration 5.0ug/ml.
![Western Blot: HMGCS2 Antibody [NBP1-54869] - Reccomended Titration: 5.0 ug/ml Positive Control: Jurkat cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14359_HMGCS2%2520Antibody-Western%2520Blot-NBP1-54869-img0004.jpg)
Western Blot: HMGCS2 Antibody [NBP1-54869] - Reccomended Titration: 5.0 ug/ml Positive Control: Jurkat cell lysate