KLC3 Antibody

Name KLC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-54772
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig
Antigen Synthetic peptides corresponding to KLC3(kinesin light chain 3) The peptide sequence was selected from the middle region of KLC3. Peptide sequence LLCQNQGKFEDVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene KLC3
Supplier Page Shop

Product images