KLC3 Antibody

Name KLC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-54771
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLC3(kinesin light chain 3) The peptide sequence was selected from the middle region of KLC3 (NP_8031360). Peptide sequence MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLC3
Conjugate Unconjugated
Supplier Page Shop

Product images