PANK4 Antibody

Name PANK4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55013
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Zebrafish
Antigen Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the middle region of PANK4. Peptide sequence LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PANK4
Supplier Page Shop

Product images