| Name | DDIT4L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55005 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DDIT4L(DNA-damage-inducible transcript 4-like) The peptide sequence was selected from the middle region of DDIT4L (NP_660287). Peptide sequence KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DDIT4L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |