NUDCD1 Antibody

Name NUDCD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55000
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NUDCD1(NudC domain containing 1) The peptide sequence was selected from the N terminal of NUDCD1. Peptide sequence EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NUDCD1
Conjugate Unconjugated
Supplier Page Shop

Product images