SNRK Antibody

Name SNRK Antibody
Supplier Novus Biologicals
Catalog NBP1-54944
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SNRK(SNF related kinase) The peptide sequence was selected from the middle region of SNRK. Peptide sequence SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SNRK
Conjugate Unconjugated
Supplier Page Shop

Product images