NUDT13 Antibody

Name NUDT13 Antibody
Supplier Novus Biologicals
Catalog NBP1-54929
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NUDT13(nudix (nucleoside diphosphate linked moiety X)-type motif 13) The peptide sequence was selected from the N terminal of NUDT13. Peptide sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NUDT13
Conjugate Unconjugated
Supplier Page Shop

Product images