METTL1 Antibody

Name METTL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54928
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to METTL1(methyltransferase like 1) The peptide sequence was selected from the middle region of METTL1. Peptide sequence KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene METTL1
Conjugate Unconjugated
Supplier Page Shop

Product images