| Name | TTC6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54927 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TTC6(tetratricopeptide repeat domain 6) The peptide sequence was selected from the C terminal of TTC6. Peptide sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TTC6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |