PDZRN4 Antibody

Name PDZRN4 Antibody
Supplier Novus Biologicals
Catalog NBP1-54925
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PDZRN4
Conjugate Unconjugated
Supplier Page Shop

Product images