FBXW2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55043
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to FBXW2(F-box and WD repeat domain containing 2) The peptide sequence was selected from the middle region of FBXW2. Peptide sequence SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FBXW2
• Conjugate: Unconjugated

Product images

Western Blot: FBXW2 Antibody [NBP1-55043] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat

Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: FBXW2 Antibody [NBP1-55043] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml