NRBP2 Antibody

Name NRBP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54969
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NRBP2(nuclear receptor binding protein 2) The peptide sequence was selected from the middle region of NRBP2. Peptide sequence VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NRBP2
Conjugate Unconjugated
Supplier Page Shop

Product images