Myotrophin Antibody

Name Myotrophin Antibody
Supplier Novus Biologicals
Catalog NBP1-54959
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MTPN(myotrophin) The peptide sequence was selected from the middle region of MTPN (NP_665807). Peptide sequence GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MTPN
Conjugate Unconjugated
Supplier Page Shop

Product images