PADI2 Antibody
| Name | PADI2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54958 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PADI2(peptidyl arginine deiminase, type II) The peptide sequence was selected from the middle region of PADI2. Peptide sequence RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PADI2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PADI2 Antibody [NBP1-54958] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14669_PADI2-Antibody-Western-Blot-NBP1-54958-img0002.jpg)
![Western Blot: PADI2 Antibody [NBP1-54958] - Hela Whole cell lysates, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14670_PADI2%2520Antibody-Western%2520Blot-NBP1-54958-img0003.jpg)