UBE3B Antibody

Name UBE3B Antibody
Supplier Novus Biologicals
Catalog NBP1-54950
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UBE3B(ubiquitin protein ligase E3B) The peptide sequence was selected from the middle region of UBE3B. Peptide sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UBE3B
Conjugate Unconjugated
Supplier Page Shop

Product images