HMGCS2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54995
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to HMGCS2(3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)) The peptide sequence was selected from the C terminal of HMGCS2. Peptide sequence DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWY
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: HMGCS2
• Conjugate: Unconjugated