Name | MTMR12 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54988 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | MTMR12 |
Supplier Page | Shop |