DPYS Antibody

Name DPYS Antibody
Supplier Novus Biologicals
Catalog NBP1-55122
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DPYS(dihydropyrimidinase) The peptide sequence was selected from the middle region of DPYS. Peptide sequence LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene DPYS
Conjugate Unconjugated
Supplier Page Shop

Product images