RhoF Antibody

Name RhoF Antibody
Supplier Novus Biologicals
Catalog NBP1-55116
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RHOF(ras homolog gene family, member F (in filopodia)) The peptide sequence was selected from the middle region of RHOF. Peptide sequence DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RHOF
Conjugate Unconjugated
Supplier Page Shop

Product images