TRIM42 Antibody

Name TRIM42 Antibody
Supplier Novus Biologicals
Catalog NBP1-55074
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRIM42(tripartite motif-containing 42) The peptide sequence was selected from the C terminal of TRIM42. Peptide sequence VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRIM42
Conjugate Unconjugated
Supplier Page Shop

Product images