RSPRY1 Antibody

Name RSPRY1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55070
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RSPRY1(ring finger and SPRY domain containing 1) The peptide sequence was selected from the N terminal of RSPRY1. Peptide sequence RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RSPRY1
Conjugate Unconjugated
Supplier Page Shop

Product images